Synthetic peptide directed towards the C terminal region of human RAB3A
Application
Anti- RAB3D antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Actions biochimiques/physiologiques
Rab3A is a synaptic vesicle-associated GTPase that regulates Ca+2-dependent exocytosis. It is ubiquitously present in nervous system and in the acrosomal region of human sperm. Rab3A forms complex with RIM and Munc13 proteins to regulate synaptic vesicles docking and acrosomal exocytosis. It is a regulator of Ca+2-dependent release of α-melanocyte stimulating hormone.
Séquence
Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Rab3a is a small GTPase of the Rab3 subfamily that acts during late stages of Ca²⁺-regulated exocytosis. Previous functional analysis in pituitary melanotrophs described Rab3a as a positive regulator of Ca²⁺-dependent exocytosis. However, the precise role of the Rab3a isoform
The Journal of neuroscience : the official journal of the Society for Neuroscience, 32(20), 6931-6936 (2012-05-18)
Rab3A is a synaptic vesicle-associated protein found throughout the nervous system, but its precise function is unknown. Genetic knock-out studies show that Rab3A is not necessary for vesicular release or replenishment at conventional synapses in the brain. Here we explore
Exocytosis is a highly regulated, multistage process consisting of multiple functionally definable stages, including recruitment, targeting, tethering, priming, and docking of secretory vesicles with the plasma membrane, followed by calcium-triggered membrane fusion. The acrosome reaction of spermatozoa is a complex
Questions
Évaluations
★★★★★ Aucune valeur de notation
Filtres actifs
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
