Skip to Content
Merck
All Photos(2)

Key Documents

WH0083881M2

Sigma-Aldrich

Monoclonal Anti-MIXL1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-MGC138179, Anti-MILD1, Anti-MIXL, Anti-Mix1 homeobox-like 1 (Xenopus laevis)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€490.00

€490.00


Estimated to ship onMay 03, 2025



Select a Size

Change View
100 μG
€490.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€490.00


Estimated to ship onMay 03, 2025


biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4D11, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgGκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... MIXL1(83881)

General description

Mix paired-like homeobox, also known as mesoderm inducer in Xenopus like 1 (MIXL1), is a homeobox transcription factor. It is induced by the transforming growth factor-β family of ligands. MIXL1 is expressed in hematopoietic stem cells and progenitor cells. The gene encoding it is localized on human chromosome 1q42.12.[1][2]

Immunogen

MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP

Biochem/physiol Actions

Mesoderm inducer in Xenopus like 1 (MIXL1) is crucial for specification of the mesoderm and endoderm during early embryogenesis. It modulates the proto-oncogene c-REL. The protein may have a role in acute myelogenous leukemia.[2]

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A role for BMP-induced homeobox gene MIXL1 in acute myelogenous leukemia and identification of type I BMP receptor as a potential target for therapy.
Raymond A
Oncotarget (2014)
Rare Germline Copy Number Variations and Disease Susceptibility in Familial Melanoma
Jianxin Shi
The Journal of Investigative Dermatology (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service