Skip to Content
Merck
All Photos(4)

Documents

WH0001906M1

Sigma-Aldrich

Monoclonal Anti-EDN1 antibody produced in mouse

clone 3D6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ET1, Anti-Endothelin 1

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3D6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EDN1(1906)

General description

Endothelin 1 (ET1) is an endothelium-derived peptide. It is synthesized as an inactive form of 212 amino acids and later converted to an active 21 amino acid peptide. The gene encoding it is localized on human chromosome 6p24.1.

Immunogen

EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW

Biochem/physiol Actions

Endothelin 1 (ET1) is a vasoconstrictor and is involved in pulmonary vascular homeostasis. ET1 has been linked to HIV (human immunodeficiency virus)-associated pulmonary arterial hypertension and endothelial dysfunction.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rushi V Parikh et al.
PloS one, 11(1), e0146355-e0146355 (2016-01-12)
HIV infection is an independent risk factor for PAH, but the underlying pathogenesis remains unclear. ET-1 is a robust vasoconstrictor and key mediator of pulmonary vascular homeostasis. Higher levels of ET-1 predict disease severity and mortality in other forms of
Alexandra B Cooke et al.
Metabolism: clinical and experimental, 64(9), 1103-1111 (2015-07-05)
Endothelin-1 (ET-1) is a potent vasoconstrictor produced by vascular endothelial cells, and a known marker of endothelial dysfunction. However, the acute and chronic effects of smoking and nicotine gum on the ET-1 response to acute physical stress in young healthy
Abdelkader Chalghoum et al.
BMC cardiovascular disorders, 15, 152-152 (2015-11-18)
Acute coronary syndromes (ACS) are complex and polygenic diseases which are a real problem of public health. These syndromes require multidisciplinary studies to understand the pathogenesis mechanisms. Our study aims to evaluate the endothelin-1 (ET-1) serum concentration in Tunisian coronary

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service