SAB2103006

Anti-SIX2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 32 kDa
• species reactivity: horse, dog, guinea pig, bovine, mouse, sheep, rat, rabbit, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_016932
• UniProt accession no.: Q9NPC8
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SIX2(10736)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human SIX2

Biochem/physiol Actions

This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila ′sine oculis′ homeobox protein. SIX2 is a transcription factor which, like other members of this gene family, may be involved in limb or eye development.

Sequence

Synthetic peptide located within the following region: WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable