HPA005464
Anti-FMNL2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Formin homology 2 domain-containing protein 2, Anti-Formin-like protein 2
Sign Into View Organizational & Contract Pricing
All Photos(4)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FMNL2(114793)
Related Categories
General description
Formin-like 2 (FMNL2) belongs to the family of diaphanous-related formins (DRF), which are ubiquitously expressed and have highly conserved domains. FMNL2 is highly expressed in mammary and gastrointestinal epithelia, placenta, reproductive tract and lymphatic tissues. FMNL2 has two isoforms due to alternative splicing, and they differ at their C-terminals. FMNL2A and FMNL2B have the characteristic FDD and formin homology1 (FH1) and FH2 domains. This gene is localized to chromosome 2q23.3.
Immunogen
Formin-like protein 2 recombinant protein epitope signature tag (PrEST)
Application
Anti-FMNL2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
Formin-like 2 (FMNL2) regulates actin cytoskeleton, and therefore controls cell motility and migration, cell adhesion, cell polarity, filopodium formation and cytokinesis. It mediates the polymerization of actin via its FH2 domain, while its FH1 domain binds to profilin. Cellular morphological changes are induced by FMNL2, via the N-myristoylation of the involved proteins. It also acts as the effector protein for GTPases belonging to Rho signaling pathway. FMNL2 is down-regulated in hepatocellular carcinoma as compared to normal hepatic epithelial cells. The lower expression of FMNL2 predicts poor prognosis and survival for hepatocellular carcinoma patients. In colorectal carcinoma, it has been implicated in maintaining the epithelial-mesenchymal transition (EMT). Studies show that this protein plays a key role in the metastasis of colorectal cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70050
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Maria Gardberg et al.
BMC cell biology, 11, 55-55 (2010-07-17)
Diaphanous-related formins govern actin-based processes involved in many cellular functions, such as cell movement and invasion. Possible connections to developmental processes and cellular changes associated with malignant phenotype make them interesting study targets. In spite of this, very little is
Hanna Grobe et al.
PloS one, 13(3), e0194716-e0194716 (2018-03-27)
De novo formation of epithelial cell-cell contacts relies on actin-based protrusions as well as tightly controlled turnover of junctional actin once cells encounter each other and adhesion complexes assemble. The specific contributions of individual actin regulators on either protrusion formation
Katharina Grikscheit et al.
The Journal of cell biology, 209(3), 367-376 (2015-05-13)
Epithelial integrity is vitally important, and its deregulation causes early stage cancer. De novo formation of an adherens junction (AJ) between single epithelial cells requires coordinated, spatial actin dynamics, but the mechanisms steering nascent actin polymerization for cell-cell adhesion initiation
Yufa Li et al.
Molecular cancer research : MCR, 8(12), 1579-1590 (2010-11-13)
FMNL2 is a member of diaphanous-related formins that control actin-dependent processes such as cell motility and invasion. Its overexpression in metastatic cell lines and tissues of colorectal carcinoma has been associated with aggressive tumor development in our previous study. But
Li Liang et al.
Human pathology, 42(11), 1603-1612 (2011-04-19)
The formin-like 2 protein is a member of the diaphanous-related formin family that controls actin-dependent processes such as cell motility and invasion. This study aimed at clarifying formin-like 2 expression in hepatocellular carcinoma and its correlation with clinicopathologic features and
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service