Skip to Content
Merck
All Photos(2)

Key Documents

AV39341

Sigma-Aldrich

Anti-TRIM62 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Tripartite motif-containing 62

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€326.00

€326.00


Estimated to ship onMay 24, 2025



Select a Size

Change View
100 μL
€326.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€326.00


Estimated to ship onMay 24, 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

54 kDa

species reactivity

rat, pig, bovine, mouse, horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TRIM62(55223)

General description

Tripartite motif containing 62 (TRIM62) is a cytoplasmic protein that functions as a RING finger E3 ubiquitin ligase. It is known to catalyze self-ubiquination[1].
Rabbit Anti-TRIM62 antibody recognizes canine, human, mouse, rat, and bovine TRIM62.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRIM62

Application

Rabbit Anti-TRIM62 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.

Sequence

Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fang Huang et al.
Biochemical and biophysical research communications, 432(2), 208-213 (2013-02-14)
TRIM62, also named DEAR1, is a member of the TRIM/RBCC family, which includes proteins with conserved RING finger, B-box and coiled-coil domains. Several reports have identified a role for this family in cancer, retroviral infection and innate immunity. In this

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service