AV39337

Anti-ZFP64 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Zinc finger protein 64 homolog (mouse)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 69 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_955459
• UniProt accession no.: Q9NPA5-2
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZFP64(55734)

Description

General description

ZFP64 is a zinc-finger protein that enhances p65 stimulation and thereby promotes TLR-induced production of pro-inflammatory cytokines and type I interferons in macrophages.
Rabbit Anti-ZFP64 antibody recognizes bovine, canine, human, and pig ZFP64.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZFP64

Application

Rabbit Anti-ZFP64 antibody is suitable for western blotting applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.

Sequence

Synthetic peptide located within the following region: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable