Skip to Content
Merck
All Photos(1)

Key Documents

AV39156

Sigma-Aldrich

Anti-ZHX2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Zinc fingers and homeoboxes 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€287.00

€287.00


Check Cart for Availability


Select a Size

Change View
100 μL
€287.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€287.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

92 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZHX2(22882)

General description

ZHX2 belongs to the zinc fingers and homeoboxes gene family and is involved in transcriptional regulation. It forms heterodimers with ZHX3. ZHX2 represses α-fetoprotein (AFP) expression in human hepatoma cells.
Rabbit Anti-ZHX2 antibody recognizes bovine, human, and canine ZHX2.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZHX2

Application

Rabbit Anti-ZHX2 antibody is suitable for western blot applications at a concentration of 5 μg/ml.

Biochem/physiol Actions

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. ZHX2 is the member 2 of this gene family. In addition to forming homodimers,this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Sequence

Synthetic peptide located within the following region: MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hiroko Kawata et al.
Gene, 323, 133-140 (2003-12-09)
Human zinc-fingers and homeoboxes (ZHX) 1, ZHX2 and ZHX3, members of the ZHX family, contain two Cys(2)-His(2)-type zinc-finger motifs and five homeodomains (HDs). These proteins not only form homodimers but heterodimers with ZHX1 as well and act as ubiquitous transcriptional
H Shen et al.
Journal of cellular and molecular medicine, 12(6B), 2772-2780 (2008-01-16)
The zinc-fingers and homeoboxes 2 (ZHX2) protein was shown previously to be involved in postnatal repression of alpha-fetoprotein (AFP) in mice. More recently, loss of ZHX2 expression was often found in human hepatcellular carcinoma (HCC), where AFP is frequently reactivated.

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service