Skip to Content
Merck
All Photos(3)

Key Documents

SAB1402307

Sigma-Aldrich

Monoclonal Anti-PGK1, (C-terminal) antibody produced in mouse

clone 2H4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

MGC117307, MGC142128, MGC8947, MIG10, PGKA

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2H4, monoclonal

form

buffered aqueous solution

mol wt

antigen ~36.41 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PGK1(5230)

General description

The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. (provided by RefSeq) Phosphoglycerate kinase 1 (PGK1) is a glycolytic enzyme. The gene encoding it is localized on human chromosome X.

Immunogen

PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

Biochem/physiol Actions

Phosphoglycerate kinase 1 (PGK1) converts 1, 3-diphosphoglycerate to 3-phosphoglycerate. Mitochondrial PGK1 phosphorylates pyruvate dehydrogenase kinase 1. PGK1 may have a role in rheumatoid arthritis. The protein is upregulated in various cancers. It is regulated by hypoxia-inducible factor-1α. It also has a role in DNA repair and angiogenesis. Deficiency of the enzyme is linked to combinations of hemolytic anemia, neurological dysfunction and myopathy.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Refinement of Linkage of Human Severe Combined
Immunodeficiency (SCIDX I) to Polymorphic Markers in Xq 1 3
Jennifer M. Puck
American Journal of Human Genetics (1993)
Mitochondria-Translocated PGK1 Functions as a Protein Kinase to Coordinate Glycolysis and the TCA Cycle in Tumorigenesis.
Li X
Molecular Cell (2016)
Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
Tamai M
International Journal of Hematology (2014)
PGK1, a glucose metabolism enzyme, may play an important role in rheumatoid arthritis.
Zhao Y
Inflammation Research (2016)
Phosphoglycerate kinase-1 is a predictor of poor survival and a novel prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
Sun S
British Journal of Cancer (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service