Skip to Content
Merck
All Photos(7)

Key Documents

HPA021488

Sigma-Aldrich

Anti-WIPI2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonym(s):

Anti-WD repeat domain phosphoinositide-interacting protein 2, Anti-WIPI-2, Anti-WIPI49-like protein 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

MKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WIPI2(26100)

General description

WD repeat domain, phosphoinositide-interacting 2 belongs to the WIPI protein family. It is localized on the autophagy membrane and plasma membrane. Apart from this, it is also present on the membranes near the golgi cisternae. WIPI2 is a mammalian orthologous of Atg18, which is ubiquitously expressed in variety of cell lines.

Immunogen

WD repeat domain phosphoinositide-interacting protein 2 recombinant protein epitope signature tag (PrEST)

Application

Anti-WIPI2 antibody produced in rabbit has been used in immunofluorescence studies. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

WIPI2 (WD repeat domain, phosphoinositide-interacting 2) plays a vital role in the transformation of omegasomes to autophagosomes. The above protein functions as a mammalian effector of phosphatidylinositol 3-phosphate (PtdIns3P). WIPI2 aids recombinant capsid protein VP1 (rVP1) in upregulating autophagy, MAPK1 (Mitogen-Activated Protein Kinase 1)/3 phosphorylation and matrix metallopeptidase 9 (MMP-9) activity, which are required for macrophage migration.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75038

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Recombinant protein rVP1 upregulates BECN1-independent autophagy, MAPK1/3 phosphorylation and MMP9 activity via WIPI1/WIPI2 to promote macrophage migration.
Liao CC
Autophagy, 9(1), 5-19 (2013)
Ultrastructural relationship of the phagophore with surrounding organelles.
Biazik J
Autophagy, 11(3), 439-451 (2015)
Freeze-fracture replica immunolabelling reveals human WIPI-1 and WIPI-2 as membrane proteins of autophagosomes.
Proikas-Cezanne T
Journal of Cellular and Molecular Medicine, 15(9), 2007-2010 (2011)
Mammalian Atg18 (WIPI2) localizes to omegasome-anchored phagophores and positively regulates LC3 lipidation.
Polson HE
Autophagy, 6(4), 506-522 (2010)
Joanna Biazik et al.
Autophagy, 11(3), 439-451 (2015-02-26)
Phagophore nucleates from a subdomain of the endoplasmic reticulum (ER) termed the omegasome and also makes contact with other organelles such as mitochondria, Golgi complex, plasma membrane and recycling endosomes during its formation. We have used serial block face scanning

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service