Skip to Content
Merck
All Photos(4)

Key Documents

HPA053457

Sigma-Aldrich

Anti-SIGLEC1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CD169, Anti-FLJ00051, Anti-FLJ00055, Anti-dJ1009E24.1, Anti-sialic acid binding Ig-like lectin 1, sialoadhesin

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIGLEC1(6614)

General description

Sialic acid-binding Ig-like lectin 1 (SIGLEC1), also known as CD169, is a myeloid-cell surface receptor that belongs to the Siglec family. It is expressed on the surface of specific macrophage subsets and its precursor monocytes. In addition, it also shows its expression on some dendritic cells or T lymphocytes. SIGLEC1 is encoded by the gene mapped to human chromosome 20p. The protein structure is characterized with 17 Ig-like domains, including an N-terminal V-set domain and 16 C2-set domains.

Immunogen

sialic acid binding Ig-like lectin 1, sialoadhesin recombinant protein epitope signature tag (PrEST)

Application

Anti-SIGLEC1 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

Sialic acid-binding Ig like lectin 1 (SIGLEC1) aids in cell-to-cell adhesion and cell-pathogen interactions. It also enables antigen presentation and induces adaptive immune responses. SIGLEC1 facilitates attenuation and induces anti-tumor immunity. It suppresses anti-viral innate immune response by inducing ubiquitin ligase tripartite motif-containing 27 (TRIM27) mediated TANK binding kinase 1 (TBK1) degradation. SIGLEC1 is used as a predictive molecular marker in several autoimmune diseases, such as Grave′s diseases. Upregulationof the SIGLEC1 has been observed in patients with systemic sclerosis (SSc).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85314

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Robert M Clancy et al.
Journal of immunology (Baltimore, Md. : 1950), 202(1), 48-55 (2018-12-07)
Given that diseases associated with anti-SSA/Ro autoantibodies, such as systemic lupus erythematosus and Sjögren syndrome, are linked with an upregulation of IFN and type I IFN-stimulated genes, including sialic acid-binding Ig-like lectin 1 (Siglec-1), a receptor on monocytes/macrophages, recent attention
Michael R York et al.
Arthritis and rheumatism, 56(3), 1010-1020 (2007-03-01)
Microarray analyses of peripheral blood leukocytes have shown that patients with systemic lupus erythematosus express increased levels of type I interferon (IFN)-regulated genes. In this study we examined gene expression by peripheral blood mononuclear cells (PBMCs) from patients with systemic
Javier Martinez-Picado et al.
Nature communications, 7, 12412-12412 (2016-08-12)
Siglec-1/CD169 is a myeloid-cell surface receptor critical for HIV-1 capture and infection of bystander target cells. To dissect the role of SIGLEC1 in natura, we scan a large population genetic database and identify a loss-of-function variant (Glu88Ter) that is found
Yu Liu et al.
Biomedical reports, 14(2), 26-26 (2021-01-08)
CD169+ macrophages are a unique type of macrophage subset that differ from M1 and M2 macrophages. CD169+ macrophages are present in multiple tissues and organs throughout the body and are primarily expressed in secondary lymphoid organs. These cells are primarily
R Biassoni et al.
Journal of cellular and molecular medicine, 7(4), 376-387 (2004-02-03)
NK cells express receptors characterized by opposite functions that finely regulate their activities. Among inhibitory receptors, some are specific for different groups of MHC class I alleles, while others are still orphan receptors. On the contrary, various activating receptors are

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service