SAB5702995

Anti-PKC epsilon Antibody, clone 8I8K4, Rabbit Monoclonal

• Synonym(s): PKCE, nPKC-epsilon
• UNSPSC Code: 12352203
• NACRES: NA.46

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 8I8K4, monoclonal
• form: liquid
• mol wt: 82 kDa
• species reactivity: mouse
• concentration: 0.94 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: RSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
• UniProt accession no.: Q02156
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PRKCE(5581)

Description

General description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PKC epsilon (Q02156).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1