Skip to Content
Merck
All Photos(3)

Key Documents

HPA037648

Sigma-Aldrich

Anti-BORCS7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C10orf32, Anti-FLJ40752

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€543.00

€543.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€543.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€543.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

FGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

BORCS7 gene encodes BLOC-1 related complex subunit 7 protein. BORCS7 is ubiquitously expressed. The gene is present on human chromosome 10q24.32.

Immunogen

BLOC-1 related complex subunit 7

Application

Anti-BORCS7 antibody produced in rabbit has been used to confirm the expression of BORCS7 protein in the human embryonic kidney cells 293 using western blot analysis.

Biochem/physiol Actions

BORC complex regulates localization of lysosome, which is critical for coordinating cellular processes. BORCS7 aids in the fusion of autophagosome with lysosome. Allelic variations in BORCS7 contribute to the occurrence of schizophrenia in humans.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80363

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A human-specific AS3MT isoform and BORCS7 are molecular risk factors in the 10q24. 32 schizophrenia-associated locus
Li M, et al.
Nature Medicine, 22(6), 649-649 (2016)
BORC, a multisubunit complex that regulates lysosome positioning
Pu J, et al.
Developmental Cell, 33(2), 176-188 (2015)
BORC coordinates encounter and fusion of lysosomes with autophagosomes
Jia R, et al.
Autophagy, 13(10), 1648-1663 (2017)
Genome-wide significant schizophrenia risk variation on chromosome 10q24 is associated with altered cis-regulation of BORCS7, AS3MT, and NT5C2 in the human brain
Duarte RRR, et al.
American Journal of Medical Genetics. Part B, Neuropsychiatric Genetics : the Official Publication of the International Society of Psychiatric Genetics, 171(6), 806-814 (2016)
Teodor E Yordanov et al.
Traffic (Copenhagen, Denmark), 20(9), 674-696 (2019-07-18)
Mechanisms that control lysosomal function are essential for cellular homeostasis. Lysosomes adapt in size and number to cellular needs but little is known about the underlying molecular mechanism. We demonstrate that the late endosomal/lysosomal multimeric BLOC-1-related complex (BORC) regulates the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service