Skip to Content
Merck
All Photos(4)

Key Documents

HPA010873

Sigma-Aldrich

Anti-ALDH9A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-γ-Aminobutyraldehyde dehydrogenase antibody produced in rabbit, Anti-4-Trimethylaminobutyraldehyde dehydrogenase antibody produced in rabbit, Anti-Aldehyde dehydrogenase 9A1 antibody produced in rabbit, Anti-Aldehyde dehydrogenase E3 isozyme antibody produced in rabbit, Anti-R-aminobutyraldehyde dehydrogenase antibody produced in rabbit, Anti-TMABADH antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€543.00

€543.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€543.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

€543.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ALDH9A1(223)

Looking for similar products? Visit Product Comparison Guide

General description

ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) gene encodes an aldehyde dehydrogenase isozyme. This gene maps to human chromosome 1q22-q23, and spans 45kb consisting of 10 exons. It has an open reading frame of 1479bp. The encoded protein consists of 493 amino acids. This gene is highly expressed in skeletal muscle, kidney and adult liver, and has lower expression in lung, pancreas, heart and brain.

Immunogen

4-Trimethylaminobutyraldehyde dehydrogenase recombinant protein epitope signature tag (PrEST)

Application

Anti-ALDH9A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) is a cytoplasmic enzyme which is involved in the metabolism of aminoaldehydes. In liver, this enzyme catalyzes the synthesis of γ-Aminobutyric acid (GABA) from γ-aminobutyraldehyde. In brain, ALDH9A1 catalyzes dehydrogenation of aldehydes such as, betaine aldehyde, acetaldehyde, propionaldehyde along with that of γ-aminobutyraldehyde. This enzyme is also thought to be involved in the production of GABA from putrescine, either directly through diamine oxidase, or indirectly through acetylated putrescine via monoamine oxidase. Studies suggest that ALDH9A1 might be the predominant aldehyde dehydrogenase responsible for carnitine biosynthesis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70697

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Marshall S Scicchitano et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 57(9), 849-860 (2009-05-28)
Global mass spectrometry (MS) profiling and spectral count quantitation are used to identify unique or differentially expressed proteins and can help identify potential biomarkers. MS has rarely been conducted in retrospective studies, because historically, available samples for protein analyses were
F M Vaz et al.
The Journal of biological chemistry, 275(10), 7390-7394 (2000-03-04)
The penultimate step in carnitine biosynthesis is mediated by gamma-trimethylaminobutyraldehyde dehydrogenase (EC 1.2.1.47), a cytosolic NAD(+)-dependent aldehyde dehydrogenase that converts gamma-trimethylaminobutyraldehyde into gamma-butyrobetaine. This enzyme was purified from rat liver, and two internal peptide fragments were sequenced by Edman degradation.
G Kurys et al.
European journal of biochemistry, 218(2), 311-320 (1993-12-01)
Human liver aldehyde dehydrogenase (E3 isozyme), with wide substrate specificity and low Km for 4-aminobutyraldehyde, was only recently characterized [Kurys, G., Ambroziak, W. & Pietruszko, R. (1989) J. Biol. Chem. 264, 4715-4721] and in this study we report on its
S W Lin et al.
Genomics, 34(3), 376-380 (1996-06-15)
The cDNA and the gene (ALDH9) for a human aldehyde dehydrogenase isozyme, which has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes, were cloned and characterized. The cDNA has an open reading frame of 1479 bp encoding
A Kikonyogo et al.
The Biochemical journal, 316 ( Pt 1), 317-324 (1996-05-15)
Enzyme purification and characterization, cDNA cloning and Northern blot analysis were the techniques utilized during this investigation to determine the identity and occurrence of the aldehyde dehydrogenase that metabolizes gamma-aminobutyraldehyde in adult human brain. The purification yielded one major protein

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service