Skip to Content
Merck
All Photos(1)

Key Documents

AV53752

Sigma-Aldrich

Anti-AGBL5 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-ATP/GTP binding protein-like 5, Anti-FLJ21839

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€423.00

€423.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€423.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€423.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... AGBL5(60509)

Immunogen

Synthetic peptide directed towards the C terminal region of human AGBL5

Application

Anti-AGBL5 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

AGBL5 (ATP/GTP binding protein-like 5) gene encodes a 886 amino acid containing protein that belongs to peptidase M14 family and is predominantly expressed in brain. AGBL5 possesses glutamylase activity and is involved in the metabolism of the polyglutamate side-chains of tubulin. It facilitates the removal of α and γ linked glutamates from tubulin.[1]

Sequence

Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Iryna Berezniuk et al.
The Journal of biological chemistry, 288(42), 30445-30453 (2013-09-12)
Cytosolic carboxypeptidase 5 (CCP5) is a member of a subfamily of enzymes that cleave C-terminal and/or side chain amino acids from tubulin. CCP5 was proposed to selectively cleave the branch point of glutamylated tubulin, based on studies involving overexpression of
Ashish Lal et al.
PLoS genetics, 7(11), e1002363-e1002363 (2011-11-22)
A simple biochemical method to isolate mRNAs pulled down with a transfected, biotinylated microRNA was used to identify direct target genes of miR-34a, a tumor suppressor gene. The method reidentified most of the known miR-34a regulated genes expressed in K562

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service