Skip to Content
Merck
All Photos(1)

Documents

AV46745

Sigma-Aldrich

Anti-CORIN antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-ATC2, Anti-CRN, Anti-Lrp4, Anti-MGC119742, Anti-TMPRSS10

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

74 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CORIN(10699)

Immunogen

Synthetic peptide directed towards the C terminal region of human CORIN

Application

Anti-CORIN antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL.

Biochem/physiol Actions

CORIN gene encodes for a single-pass type II membrane protein. It is a transmembrane cardiac serine protease that plays a pivotal role in converting pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide that regulates blood volume and pressure. In pregnant female, it stimulates the trophoblast invasion and spiral artery remodeling in uterus. Additionally, soluble corin facilitates as a potent biomarker for heart failure (HF).

Sequence

Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Joshua R Huot et al.
American journal of cancer research, 11(6), 2990-3001 (2021-07-13)
Skeletal muscle wasting and weakness caused by cancer and its treatments (known as "cachexia") drastically impair quality of life and worsen survival outcomes in cancer patients. There are currently no approved treatments for cachexia. Hence, further investigation into the causes
W Yan et al.
Proceedings of the National Academy of Sciences of the United States of America, 97(15), 8525-8529 (2000-07-06)
Atrial natriuretic peptide (ANP) is a cardiac hormone essential for the regulation of blood pressure. In cardiac myocytes, ANP is synthesized as a precursor, pro-ANP, that is converted to biologically active ANP by an unknown membrane-associated protease. Recently, we cloned
Yujie Cui et al.
Nature, 484(7393), 246-250 (2012-03-23)
In pregnancy, trophoblast invasion and uterine spiral artery remodelling are important for lowering maternal vascular resistance and increasing uteroplacental blood flow. Impaired spiral artery remodelling has been implicated in pre-eclampsia, a major complication of pregnancy, for a long time but
Ningzheng Dong et al.
Clinica chimica acta; international journal of clinical chemistry, 413(3-4), 378-383 (2011-11-19)
Corin is a transmembrane serine protease identified in the heart, where it converts natriuretic peptides from inactive precursors to mature active forms. Studies in animal models and patients with hypertension and heart disease demonstrate that corin is critical in maintaining

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service