Synthetic peptide directed towards the C terminal region of human UST
Application
Anti-UST antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μ/mL.
Biochem/physiol Actions
UST (Uronyl-2-sulfotransferase) gene encodes for an enzyme that transfers sulfate to the 2-position of uronyl residues, in iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate. In chondroitin sulfate the sulfate group transfer occurs from 3′-phosphoadenosine 5′-phosphosulfate (PAPS) to position 2 of the GlcA residue.
Sequence
Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of biological chemistry, 274(15), 10474-10480 (1999-04-03)
A partial-length human cDNA with a predicted amino acid sequence homologous to a previously described heparan sulfate iduronyl 2-sulfotransferase (Kobayashi, M., Habuchi, H., Yoneda, M., Habuchi, O., and Kimata, K. (1997) J. Biol. Chem. 272, 13980-13985) was obtained by searching
The Journal of biological chemistry, 280(47), 39115-39123 (2005-09-30)
We have shown previously that a highly sulfated sequence, GalNAc(4,6-SO(4))-GlcA(2SO(4))-GalNAc(6SO(4)), is present at the nonreducing terminal of chondroitin sulfate (CS), and this structure was synthesized from a unique sequence, GalNAc(4SO(4))-GlcA(2SO(4))-GalNAc(6SO(4)), by sulfation with N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase. Uronosyl 2-O-sulfotrasferase (2OST), which
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.