Skip to Content
Merck
All Photos(4)

Key Documents

HPA037655

Sigma-Aldrich

Anti-GUCY2C antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-GUC2C, Anti-Guanylate cyclase 2C (heat stable enterotoxin receptor), Anti-STAR

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GUCY2C(2984)

General description

The guanylate cyclase 2C (GUCY2C) gene, mapped to human chromosome 12p12, codes for the transmembrane receptor guanylate cyclase C (GC-C). The encoded protein is expressed in intestine.

Immunogen

guanylate cyclase 2C (heat stable enterotoxin receptor) recombinant protein epitope signature tag (PrEST)

Application

GUCY2C antibody produced in rabbit has been used for western blot analysis.

Biochem/physiol Actions

Transmembrane receptor guanylate cyclase C (GC-C), encoded by guanylate cyclase 2C (GUCY2C), regulates the secretion of chloride. Alteration in the gene expression leads to congenital sodium diarrhoea (CSD). GUCY2C catalyzes the conversion of guanosine-5′-triphosphate (GTP) to cyclic guanosine monophosphate (cGMP), upon binding of its ligand guanylin and uroguanylin, which are paracrine hormones. GUCY2C functions as a tumor suppressor and hinders intestinal tumorigenesis by inhibiting the protein kinase B/AKT signaling pathway.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79587

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Congenital secretory diarrhoea caused by activating germline mutations in GUCY2C.
Muller T
Gut, 65, 1306-1313 (2016)
Aarón Otero et al.
Frontiers in endocrinology, 14, 1185456-1185456 (2023-06-05)
Obesity contributes to ectopic fat deposition in non-adipose organs, including the pancreas. Pancreas steatosis associates with inflammation and β-cell dysfunction, contributing to the onset of insulin resistance and type 2 diabetes. An improvement of pancreatic steatosis and indices of insulin
Guanylin and uroguanylin stimulate lipolysis in human visceral adipocytes.
Rodriguez A
International Journal of Obesity, 40, 1405-1415 (2016)
Localization of the guanylyl cyclase C gene to mouse chromosome 6 and human chromosome 12p12.
Mann EA
Genomics, 34, 265-267 (1996)
The hormone receptor GUCY2C suppresses intestinal tumor formation by inhibiting AKT signaling.
Lin JE
Gastroenterology, 138, 241-254 (2010)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service