AV49075

Anti-ST6GALNAC3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-PRO7177, Anti-SIAT7C, Anti-ST6-N-acetylgalactosaminide α-2,6-sialyltransferase 3, Anti-ST6GALNACIII
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: human, rat, horse, dog, mouse, pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_694541
• UniProt accession no.: Q8NDV1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ST6GALNAC3(256435)

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human ST6GALNAC3

Application

Anti-ST6GALNAC3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (ST6GALNAC3; STY) catalyzes the transfer of sialic acids from CMP-sialic acid to glycoproteins and glycolipids. It is highly expressed in kidney and brain.

Sequence

Synthetic peptide located within the following region: HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable