WH0029907M1

Monoclonal Anti-SNX15 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-HSAF001435, Anti-sorting nexin 15
• Número MDL: MFCD03455983
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1D4, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG3κ
• Nº de acceso GenBank: NM_013306
• Nº de acceso UniProt: Q9NRS6
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SNX15(29907)

Descripción

Descripción general

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. Overexpression of this gene results in a decrease in the processing of insulin and hepatocyte growth factor receptors to their mature subunits. This decrease is caused by the mislocalization of furin, the endoprotease responsible for cleavage of insulin and hepatocyte growth factor receptors. This protein is involved in endosomal trafficking from the plasma membrane to recycling endosomes or the trans-Golgi network. This gene encodes two transcript variants encoding distinct isoforms. (provided by RefSeq)

Inmunógeno

SNX15 (NP_037438, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLH

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)