Saltar al contenido
Merck
Todas las fotos(1)

Documentos

WH0023404M6

Sigma-Aldrich

Monoclonal Anti-EXOSC2 antibody produced in mouse

clone 4B6, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-RRP4, Anti-Rrp4p, Anti-exosome component 2, Anti-hRrp4p, Anti-p7

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4B6, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable

isotipo

IgG2aκ

Nº de acceso GenBank

NM_014285

Nº de acceso UniProt

Q13868

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... EXOSC2(23404)

Descripción general

EXOSC2 (Exosome component 2) is a non-catalytic subunit of the eukaryotic RNA exosome. It is localized in the nucleus and in the cytoplasm.

Inmunógeno

EXOSC2 (NP_055100, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS

Acciones bioquímicas o fisiológicas

EXOSC2 (Exosome component 2) is associated with several cellular processes such as rRNA processing, RNA degradation from the 3′ end, 3′ to 5′ decay of the mRNA body after its deadenylation. Exosome complex is an ~400kDa multimeric complex, which plays a vital role in substrate recognition. EXOSC2 functions as a cofactor in the maintenance of human exosome integrity and efficient degradation and/or metabolism of various RNA classes.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Daniel L Kiss et al.
RNA (New York, N.Y.), 16(4), 781-791 (2010-02-27)
The RNA processing exosome complex was originally defined as an evolutionarily conserved multisubunit complex of ribonucleases responsible for the processing and/or turnover of stable RNAs. The exosome complex is also involved in the surveillance of mRNAs in both the nucleus
Rafal Tomecki et al.
The EMBO journal, 29(14), 2342-2357 (2010-06-10)
The eukaryotic RNA exosome is a ribonucleolytic complex involved in RNA processing and turnover. It consists of a nine-subunit catalytically inert core that serves a structural function and participates in substrate recognition. Best defined in Saccharomyces cerevisiae, enzymatic activity comes

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico