WH0011074M3

Monoclonal Anti-TRIM31 antibody produced in mouse

clone 2G11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-C6orf13, Anti-HCG1, Anti-HCGI, Anti-RNF, Anti-tripartite motif-containing 31
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2G11, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso GenBank: NM_007028
• Nº de acceso UniProt: Q9BZY9
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TRIM31(11074)

Descripción

Descripción general

TRIM31 (tripartite motif-containing 31) belongs to TRIM (tripartite motif-containing protein) family. It is particularly expressed in the gastrointestinal tract. TRIM31 contains carboxy-terminal PRY and SPRY (spla kinase and ryanodine receptor) domains. It is usually located in the cytoplasm, but a fraction of TRIM31 is present in the mitochondria. TRIM31 is located on human chromosome 6p22.1.

Inmunógeno

TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE

Acciones bioquímicas o fisiológicas

Overexpression of TRIM31 (tripartite motif-containing 31) suppresses anchorage-independent cell growth generated by the active form of c-Src. It is expected to play a major role in gastrointestinal tissue-specific regulation of cell proliferation.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)