Saltar al contenido
Merck
Todas las fotos(7)

Documentos

WH0006598M1

Sigma-Aldrich

Monoclonal Anti-SMARCB1 antibody produced in mouse

clone 3E10, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-BAF47, Anti-INI1, Anti-RDT, Anti-SNF5, Anti-SNF5L1, Anti-SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1, Anti-Sfh1p, Anti-Snr1, Anti-hSNFS

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(7)

About This Item

Número MDL:
MFCD04118401
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3E10, monoclonal

formulario

buffered aqueous solution

reactividad de especies

mouse

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

NM_003073

Nº de acceso UniProt

Q9Z0H3

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SMARCB1(6598)

Descripción general

SMARCB1, switch/sucrose nonfermenting (SWI/SNF) related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 is a core subunit of the SWI/SNF complex. It is a nuclear protein showing ubiquitous expression. SMARCB1 gene is mapped to human chromosome 22q11.23.

Inmunógeno

SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA

Acciones bioquímicas o fisiológicas

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1) participates in cell cycle progression and epigenetic regulation. It blocks cyclin-dependent kinase (CDK4/6) and cyclin D1 and participates in regulating the wingless (Wnt)/β-catenin signaling pathway. Mutations in the SMARCB1 gene is implicated with severe neurodevelopmental deficits, central nervous system (CNS) structural abnormalities, and seizures. It is associated with the pathophysiology of rare congenital malformation namely, Coffin-Siris syndrome (CSS). Loss of the SMARCB1 gene is linked to the malignant rhabdoid tumor (MRT), a rare childhood cancer. Moreover, MARCB1 gene abnormalities are correlated to gastrointestinal (GI) and sino-nasal carcinoma epithelioid sarcoma (ES), and renal medullary carcinoma (RMC).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sangeetha N Kalimuthu et al.
Journal of clinical pathology, 69(6), 484-489 (2016-03-05)
SMARCB1 is the core subunit of the SWI/sucrose non-fermenting ATP-dependent chromatin remodelling complex located on the long arm of chromosome 22 (22q11.2). Since discovering genetic alterations of the SMARCB1 gene in malignant rhabdoid tumours, the family of tumours harbouring loss
Tomoki Kosho et al.
American journal of medical genetics. Part C, Seminars in medical genetics, 166C(3), 262-275 (2014-08-30)
Coffin-Siris syndrome (CSS) is a rare congenital malformation syndrome, recently found to be caused by mutations in several genes encoding components of the BAF complex. To date, 109 patients have been reported with their mutations: SMARCB1 (12%), SMARCA4 (11%), SMARCE1
Shih-Chiang Huang et al.
Genes, chromosomes & cancer, 55(10), 767-776 (2016-05-25)
SMARCB1 inactivation occurs in a variety of tumors, being caused by various genetic mechanisms. Since SMARCB1 and EWSR1 genes are located close to each other on chromosome 22, larger SMARCB1 deletions may encompass the EWSR1 locus. Herein, we report four

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico