Saltar al contenido
Merck
Todas las fotos(3)

Documentos

WH0004904M1

Sigma-Aldrich

Monoclonal Anti-YBX1 antibody produced in mouse

clone 4F12, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-BP8, Anti-CSDB, Anti-DBPB, Anti-MDRNF1, Anti-MGC104858, Anti-MGC110976, Anti-NSEP1, Anti-YB1, Anti-YBX1, Anti-nuclease sensitive element binding protein 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4F12, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

NM_004559

Nº de acceso UniProt

P67809

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... YBX1(4904)

Descripción general

Y-box binding protein 1 (YBX1) gene codes for Y-box protein 1 (YB-1) that has 324 amino acid residues, 8 exons and 7 introns. It is a member of the family of multifunctional DNA/RNA binding proteins. It is mainly present in the cytosol. YBX1 gene is mapped to human chromosome 1p34.

Inmunógeno

YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA

Acciones bioquímicas o fisiológicas

Y-box binding protein 1 (YBX1) participates in pre-mRNA splicing, transcriptional regulation and mRNA translation and stability. It is also involved in DNA repair and environmental stress responses and chromatin remodeling.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

YBX1 (Y box binding protein 1)
Evdokimova V and Sorokin A
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Andreas Zaucker et al.
Nucleic acids research, 46(1), 104-119 (2017-10-24)
In many organisms, transcriptional and post-transcriptional regulation of components of pathways or processes has been reported. However, to date, there are few reports of translational co-regulation of multiple components of a developmental signaling pathway. Here, we show that an RNA
Jiawei Sun et al.
Development (Cambridge, England), 145(19) (2018-08-24)
Maternal mRNAs and proteins dictate early embryonic development before zygotic genome activation. In the absence of transcription, elaborate control of maternal mRNA translation is of particular importance for oocyte maturation and early embryogenesis. By analyzing zebrafish ybx1 mutants with a

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico