WH0003569M1

Monoclonal Anti-IL6 antibody produced in mouse

clone 3E4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6, Anti-interleukin 6 (interferon, beta 2)
• Número MDL: MFCD00162579
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3E4, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso GenBank: NM_000600
• Nº de acceso UniProt: P05231
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... IL6(3569)

Descripción

Descripción general

Interleukin-6 (IL-6) is a proinflammatory cytokine. The gene encoding it has five exons and is located on human chromosome 7. Human IL-6 is a 21–26 kDa glycoprotein. It has 212 amino acids along with a 28-amino-acid-signal peptide.

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

Inmunógeno

IL6 (NP_000591, 29 a.a. ~ 212 a.a) recombinant protein.

Sequence
SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Acciones bioquímicas o fisiológicas

Interleukin-6 (IL-6) plays a vital role in intracellular signaling pathways. The protein is linked with cancerous cell metastasis and growth. IL-6 serves as a modulator of estrogen synthesis and aromatase activity. IL-6 stimulates immunoglobulin synthesis.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)