Saltar al contenido
Merck
Todas las fotos(3)

Documentos

WH0001591M7

Sigma-Aldrich

Monoclonal Anti-CYP24A1 antibody produced in mouse

clone 1F8, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-CP24, Anti-CYP24, Anti-MGC126273, Anti-MGC126274, Anti-P450CC24, Anti-cytochrome P450, family 24, subfamily A, polypeptide 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1F8, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

ELISA: suitable
capture ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CYP24A1(1591)

Categorías relacionadas

Descripción general

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

Acciones bioquímicas o fisiológicas

Cytochrome P450 family 24 subfamily A member 1 (CYP24A1) plays a vital role in side-chain oxidation of steroid hormone vitamin D. Variation in or increased expression of CYP24A1 results in colorectal cancer (CRC); thus, CYP24A1 has potential as a biomarker for CRC. Biallelic mutation of CYP24A1 is observed in patients with idiopathic infantile hypercalcemia (IIH), low parathyroid hormone (PTH), renal disease, and it might also increase the risk of nephrocalcinosis in adults. Promoter polymorphism in the CYP24A1 gene leads to thechronic inflammatory skin disease called atopic dermatitis (AD) in adults. CYP24A1 transcript is highly expressed in ovary and lung tumors, but its expression is decreased in breast tumor when compared to the analogous normal tissues.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Mark G Anderson et al.
Cancer chemotherapy and pharmacology, 57(2), 234-240 (2005-09-24)
1,25-dihydroxyvitamin D3 (1,25(OH)2D3) and its analogues have been shown to inhibit proliferation of human cancer cells mediated by vitamin D receptor (VDR). The over-expression of 25-hydroxyvitamin D-24-hydroxylase (CYP24A1), an enzyme involved in the metabolism of 1,25(OH)2D3 and its analogues, is
Nicole Ball et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 38(3), 414-426 (2023-01-11)
Loss-of-function mutations in the CYP24A1 protein-coding region causing reduced 25 hydroxyvitamin D (25OHD) and 1,25 dihydroxyvitamin D (1,25(OH)2 D) catabolism have been observed in some cases of infantile hypercalcemia type 1 (HCINF1), which can manifest as nephrocalcinosis, hypercalcemia and adult-onset
M Cools et al.
Bone, 81, 89-96 (2015-06-29)
Bi-allelic CYP24A1 mutations can cause idiopathic infantile hypercalcemia (IIH), adult-onset nephrocalcinosis, and possibly bone metabolism disturbances. It is currently unclear if heterozygous carriers experience clinical problems or biochemical abnormalities. Our objective is to gain insight in the biochemical profile and
Xabier Garcia-Albeniz et al.
British journal of cancer, 114(2), 221-229 (2016-01-15)
Menopausal hormone therapy (MHT) use has been consistently associated with a decreased risk of colorectal cancer (CRC) in women. Our aim was to use a genome-wide gene-environment interaction analysis to identify genetic modifiers of CRC risk associated with use of
Hongyan Sun et al.
Human pathology, 50, 101-108 (2016-03-22)
Our study aims to fully evaluate clinicopathological and prognostic values of CYP24A1 in colorectal cancer (CRC) patients. Tissue microarrays of formalin-fixed and paraffin-embedded tumor samples and matched adjacent nontumor colorectal tissues from 99 CRC patients were studied for CYP24A1 protein

Artículos

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico