SAB5702948

Anti-E-Cadherin Antibody, clone 2Q9Y7, Rabbit Monoclonal

• Sinónimos: Arc-1,CD324,CDHE,ECAD,LCAM,UVO,CDH1,E-Cadherin
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 2Q9Y7, monoclonal
• formulario: liquid
• mol peso: 135 kDa
• reactividad de especies: human, rat, rat
• concentración: 1.00 mg/mL
• técnicas: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR
• Nº de acceso UniProt: P12830
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: mouse ... CDH1(999)

Descripción

Descripción general

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16.

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Aplicación

WB, IHC, IF/ICC

Información de seguridad

• Pictogramas: GHS07,GHS09
• Palabra de señalización: Warning
• Frases de peligro: H317,H411
• Consejos de prudencia: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Clasificaciones de peligro: Aquatic Chronic 2 - Skin Sens. 1
• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3