SAB5702319

Anti-CD35/CR1 Antibody, clone 2A0Q1, Rabbit Monoclonal

• Sinónimos: C3BR, C4BR, CD35, KN
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 2A0Q1, monoclonal
• formulario: liquid
• reactividad de especies: human, rat, rat
• concentración: 1.10 mg/mL
• técnicas: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
• Nº de acceso UniProt: P17927
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CR1(1378)

Descripción

Descripción general

This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in its gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus and sarcoidosis. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria. Alternate allele-specific splice variants, encoding different isoforms, have been characterized. Additional allele specific isoforms, including a secreted form, have been described but have not been fully characterized. [provided by RefSeq, Jul 2008]

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicación

IHC, IF/ICC

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1