SAB5702264

Anti-TIMP2 Antibody, clone 8R5Q2, Rabbit Monoclonal

• Sinónimos: TIMP2,CSC-21K,DDC8
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 8R5Q2, monoclonal
• formulario: liquid
• mol peso: 22 kDa
• reactividad de especies: African green monkey, rat, mouse, human
• concentración: 1.00 mg/mL
• técnicas: western blot: 1:500 - 1:1000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
• Nº de acceso UniProt: P16035
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TIMP2(7077)

Descripción

Descripción general

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.

Inmunógeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant protein of human TIMP2.

Aplicación

WB

Información de seguridad

• Pictogramas: GHS07,GHS09
• Palabra de señalización: Warning
• Frases de peligro: H317,H411
• Consejos de prudencia: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Clasificaciones de peligro: Aquatic Chronic 2 - Skin Sens. 1
• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3