SAB2108215

Anti-SERPINA3 antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 45kDa
• reactividad de especies: human, mouse, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunoblotting: suitable
• Nº de acceso NCBI: NM_001085
• Nº de acceso UniProt: P01011
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SERPINA3(12)

Descripción

Descripción general

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) is also termed as α1-antichymotrypsin (α1-ACT). It is a 68 kDa serine protease inhibitor, secreted by the liver. It belongs to the serpin superfamily of protease inhibitors. SERPINA3 is located on human chromosome 14q32.1.

Inmunógeno

Synthetic peptide directed towards the middle region of human SERPINA3

Acciones bioquímicas o fisiológicas

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) can block the functions of various serine proteases like chymotrypsin and cathepsin G. It serves as a novel predictor of clinical outcomes and a potential therapeutic target of EC (endometrial carcinoma). SERPINA3 plays a major role in melanoma invasion and migration in extracellular matrix.

Secuencia

Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable