Saltar al contenido
Merck
Todas las fotos(1)

Documentos

SAB2105153

Sigma-Aldrich

Anti-TFF1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-BCEI, Anti-D21S21, Anti-HPS2, Anti-pNR-2, A

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

7 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TFF1(7031)

Descripción general

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.
Trefoil factor 1 (TFF1) also known as breast cancer estrogen-inducible protein (BCEI) and pS2 protein, is highly expressed in the gastrointestinal mucosa. The protein was first characterized in the breast cancer cell line MCF-7. The gene TFF1 is localized on human chromosome 21q22.3.

Inmunógeno

Synthetic peptide directed towards the middle region of human TFF1

Acciones bioquímicas o fisiológicas

The major functions of TFF1 are mucosal repair incase of damage and maintenance of mucosal integrity. TFF1 promotes cell migration in breast cancer cells in response to estrogen. TFF1 is a tumour suppressor gene in gastric cancer and the mutation of which leads to development and progression of gastric cancer. TFF1 is an important marker in lobular endocervical glandular hyperplasia. TFF1 is a potent inhibitor of growth of calcium oxalate crystal growth in renal tubules.

Secuencia

Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Aberrant expression of TFF1, TFF2, and PDX1 and their diagnostic value in lobular endocervical glandular hyperplasia
Ota H, et al.
American Journal of Clinical Pathology, 135(2), 253-261 (2011)
The estrogen-regulated protein, TFF1, stimulates migration of human breast cancer cells
Prest SJ, et al.
Faseb Journal, 16(6), 592-594 (2002)
Loss of heterozygosity and promoter methylation, but not mutation, may underlie loss of TFF1 in gastric carcinoma
Carvalho R, et al.
Laboratory Investigation; a Journal of Technical Methods and Pathology, 82(10), 1319-1326 (2002)
Identification of human urinary trefoil factor 1 as a novel calcium oxalate crystal growth inhibitor
Chutipongtanate S, et al.
The Journal of Clinical Investigation, 115(12), 3613-3622 (2005)
The pS2/TFF1 trefoil factor, from basic research to clinical applications
Ribieras ST, et al.
Biochimica et Biophysica Acta - Reviews on Cancer, 1378(1), F61-F77 (1998)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico