SAB2102838

Anti-ZNF263 (ab2) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FPM315, Anti-ZKSCAN12, Anti-Zinc finger protein 263
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 77 kDa
• reactividad de especies: horse, bovine, dog, human, rabbit, guinea pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso UniProt: O14978
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ZNF263(10127)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human ZNF263

Acciones bioquímicas o fisiológicas

ZNF263 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF263 might play an important role in basic cellular processes as a transcriptional repressor.

Secuencia

Synthetic peptide located within the following region: CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable