SAB2102610

Anti-TUT1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ21850, Anti-FLJ22267, Anti-FLJ22347, Anti-MGC131987, Anti-Terminal uridylyl transferase 1, U6 snRNA-specific
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 94 kDa
• reactividad de especies: guinea pig, bovine, human, horse, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso UniProt: Q9H6E5
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TUT1(64852)

Descripción

Descripción general

The previously assigned protein identifier A8K995 has been merged into Q9H6E5. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TUT1

Acciones bioquímicas o fisiológicas

TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3′ end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].

Secuencia

Synthetic peptide located within the following region: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable