Saltar al contenido
Merck
Todas las fotos(2)

Documentos

SAB2102222

Sigma-Aldrich

Anti-SLC6A1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-GABATHG, Anti-GABATR, Anti-GAT1, Anti-Solute carrier family 6 (neurotransmitter transporter, GABA), member 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Número MDL:
MFCD01633367
Código UNSPSC:
12352203

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

67 kDa

reactividad de especies

mouse, guinea pig, rat, dog, bovine, human, horse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso UniProt

P30531

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC6A1(6529)

Inmunógeno

Synthetic peptide directed towards the middle region of human SLC6A1

Acciones bioquímicas o fisiológicas

SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.

Secuencia

Synthetic peptide located within the following region: CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

12 - Non Combustible Liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

J Kim et al.
Neuroscience, 262, 129-142 (2014-01-15)
GABA is a predominant inhibitory neurotransmitter in the CNS. Released GABA is removed from the synaptic cleft by two GABA transporters (GATs), GAT-1 and GAT-3, and their dysfunction affects brain functions. The present study aimed to reveal the ontogeny of

Artículos

Protein-based Drug Transport

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico