Saltar al contenido
Merck
Todas las fotos(1)

Documentos

SAB2101148

Sigma-Aldrich

Anti-IL15 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-IL-15, Anti-Interleukin 15, Anti-MGC9721

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Número MDL:
MFCD01635264
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

13 kDa

reactividad de especies

dog, horse, bovine, mouse, pig, human, sheep, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso UniProt

P40933

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... IL15(3600)

Descripción general

Interleukin-15 (IL-15), a cytokine, belongs to the 4α-helix bundle cytokine family. IL-15 gene is located on human chromosome 4q31.2.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human IL15

Acciones bioquímicas o fisiológicas

Interleukin-15 (IL-15) can activate inflammatory cell recruitment, angiogenesis, and synthesis of other inflammatory cytokines. It plays a key role in the progression, homeostatic proliferation, and activation of natural killer (NK) cells, natural killer T (NKT) cells, and intestinal intraepithelial lymphocytes (IELs). IL-15 plays a crucial role in the homeostatic modulation of the cluster of differentiation 8 (CD8) memory T cells. IL-15 upregulates the expression of telomerase and aids in enhancing the proliferative capacity of NK, NKT-like, and CD8 T Cells. Mutation in the IL-15 gene results in psoriasis vulgaris.

Secuencia

Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Fiona Watkinson et al.
Frontiers in immunology, 11, 594620-594620 (2021-02-05)
Interleukin-15 (IL-15) is a cytokine that has been shown to expand CD8 T cell and natural killer (NK) cell populations, and therefore has potential for potentiating adoptive immune cell therapy for cancer. Previously, IL-15 has been shown to induce proliferation
X Tan et al.
Genes and immunity, 7(5), 407-416 (2006-06-23)
Previous studies have identified mRNA three isoforms encoding interleukin-15 (IL-15) that are produced through differential splicing and encode for the same mature IL-15 protein with two different signal peptides. Our analysis of mouse intestinal epithelial cells revealed two new IL-15
Xue-Jun Zhang et al.
The Journal of investigative dermatology, 127(11), 2544-2551 (2007-06-08)
Through a series of linkage analyses in a large Chinese family cohort of psoriasis, we previously identified and confirmed a non-HLA psoriasis linkage locus PSORS9 within a small region at 4q31.2-32.1. Within the critical region of the PSORS9 locus, IL-15

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico