Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

SAB2100988

Sigma-Aldrich

Anti-GTF2E2 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-FE, Anti-General transcription factor IIE, polypeptide 2, β 34kDa, Anti-TF2E2, Anti-TFIIE-B

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

33 kDa

reactividad de especies

rabbit, goat, rat, mouse, dog, guinea pig, horse, bovine, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso UniProt

P29084

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... GTF2E2(2961)

Inmunógeno

Synthetic peptide directed towards the middle region of human GTF2E2

Acciones bioquímicas o fisiológicas

GTF2E2 belongs to the TFIIE beta subunit family.It recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.

Secuencia

Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Christiane Kuschal et al.
American journal of human genetics, 98(4), 627-642 (2016-03-22)
The general transcription factor IIE (TFIIE) is essential for transcription initiation by RNA polymerase II (RNA pol II) via direct interaction with the basal transcription/DNA repair factor IIH (TFIIH). TFIIH harbors mutations in two rare genetic disorders, the cancer-prone xeroderma
Aki Tanaka et al.
Genes to cells : devoted to molecular & cellular mechanisms, 14(3), 395-405 (2009-02-13)
The human general transcription factor, TFIIE, consists of two subunits, alpha and beta. Structural analyses indicated the presence of a forkhead motif within the central region of TFIIEbeta. This motif was essential for transcription and possessed a double-stranded DNA-binding activity.
Tomomichi Watanabe et al.
Molecular and cellular biology, 23(8), 2914-2926 (2003-04-01)
The general transcription factor TFIIE plays essential roles in both transcription initiation and the transition from initiation to elongation. Previously, we systematically deleted the structural motifs and characteristic sequences of the small subunit of human TFIIE (hTFIIE beta) to map
Angelica Ronald et al.
Behavior genetics, 40(1), 31-45 (2009-12-17)
Two separate genome-wide association studies were conducted to identify single nucleotide polymorphisms (SNPs) associated with social and nonsocial autistic-like traits. We predicted that we would find SNPs associated with social and non-social autistic-like traits and that different SNPs would be

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico