Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2100330

Sigma-Aldrich

Anti-CACNB2 (ab1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Calcium channel, voltage-dependent, β 2 subunit, Anti-FLJ23743, Anti-MYSB

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

68 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso UniProt

Q08289

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CACNB2(783)

Descripción general

Calcium voltage-gated channel auxiliary subunit beta 2 (CACNB2) is a part of voltage-gated calcium channel gene superfamily and encodes Cavβ2 subunit. In human chromosome, the gene CACNB2 is localized on 10p12.33-p12.31.

Inmunógeno

Synthetic peptide directed towards the middle region of human CACNB2

Acciones bioquímicas o fisiológicas

CACNB2 contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4). CACNB2 is associated with systolic blood pressure and hypertension. Downregulation of CACNB2 expression leads to atrial fibrillation. Mutations in CACNB2 causes dysregulation of calcium levels in cells leading to autism spectrum disorder. Single nucleotide polymorphism in CACNB2 gene is associated with bipolar disorder and schizophrenia.

Secuencia

Synthetic peptide located within the following region: HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis
Smoller JW
Lancet, 381(9875), 1371-1379 (2013)
The dark side of the QT interval. The Short QT Syndrome: pathophysiology, clinical presentation and management
Comelli I, et al.
Emergency Care Journal, 8(3), 41-47 (2012)
Regulation of cardiac CACNB2 by microRNA-499: Potential role in atrial fibrillation
Ling TY, et al.
BBA Clinical, 7(9875), 78-84 (2017)
Alexandra F S Breitenkamp et al.
PloS one, 9(4), e95579-e95579 (2014-04-23)
Autism Spectrum Disorders (ASD) are complex neurodevelopmental diseases clinically defined by dysfunction of social interaction. Dysregulation of cellular calcium homeostasis might be involved in ASD pathogenesis, and genes coding for the L-type calcium channel subunits CaV1.2 (CACNA1C) and CaVβ2 (CACNB2)
Yinghua Lin et al.
Atherosclerosis, 219(2), 709-714 (2011-10-04)
Two large-scale genome-wide association studies (GWAs) have identified multiple variants associated with blood pressure (BP) or hypertension. The present study was to investigate whether some variations were associated with BP traits and hypertension or even prehypertension in adult She ethnic

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico