SAB2100062

Anti-ADNP antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ADNP1, Anti-Activity-dependent neuroprotector homeobox, Anti-KIAA0784
• Número MDL: MFCD03454705
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 124 kDa
• reactividad de especies: dog, human, rabbit, horse, bovine, mouse, guinea pig, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso UniProt: Q9H2P0
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... ADNP(23394)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ADNP

Acciones bioquímicas o fisiológicas

Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. ADNP is a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. It contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. It is also upregulated in normal proliferative tissues. Finally, ADNP may increase the viability of certain cell types through modulation of p53 activity.Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described.

Secuencia

Synthetic peptide located within the following region: EDFKQFEPNDFYLKNTTWEDVGLWDPSLTKNQDYRTKPFCCSACPFSSKF

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable