SAB1412362
ANTI-TBX18 antibody produced in mouse
clone 4D3, purified immunoglobulin, buffered aqueous solution
Sinónimos:
TBX18
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
mouse
conjugado
unconjugated
forma del anticuerpo
purified immunoglobulin
tipo de anticuerpo
primary antibodies
clon
4D3, monoclonal
formulario
buffered aqueous solution
mol peso
antigen 37.4 kDa
reactividad de especies
, human,
técnicas
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotipo
IgG2aκ
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
dry ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... TBX18(9096)
Descripción general
T-box transcription factor 18 (TBX18) belongs to the TBX family of transcription factors. It contains a conserved T-box domain and an N-terminal nuclear localization signal (NLS). The TBX18 gene is mapped to human chromosome 6q14.3
Inmunógeno
TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Aplicación
ANTI-TBX18 antibody produced in mouse has been used in immunofluorescence staining.
Acciones bioquímicas o fisiológicas
T-box transcription factor 18 (TBX18) is involved in the sinoatrial node (SAN) formation and is expressed in the development and differentiation stages. It is a crucial factor for the pacemaker cell formation from cardiomyocytes. TBX18 may be implicated in congenital heart defects and congenital anomalies of the kidneys and urinary tract (CAKUT).
Forma física
Solution in phosphate buffered saline, pH 7.4
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
NODAL inhibition promotes differentiation of pacemaker-like cardiomyocytes from human induced pluripotent stem cells
Yechikov S, et al.
Stem Cell Research (2021)
Henner F Farin et al.
The Journal of biological chemistry, 282(35), 25748-25759 (2007-06-23)
Tbox18 (Tbx18) and Tbox15 (Tbx15) encode a closely related pair of vertebrate-specific T-box (Tbx) transcription factors. Functional analyses in the mouse have proven the requirement of Tbx15 in skin and skeletal development and of Tbx18 in the formation of the
Sergey Yechikov et al.
Stem cell research, 49, 102043-102043 (2020-11-01)
Directed cardiomyogenesis from human induced pluripotent stem cells (hiPSCs) has been greatly improved in the last decade but directed differentiation to pacemaking cardiomyocytes (CMs) remains incompletely understood. In this study, we demonstrated that inhibition of NODAL signaling by a specific
Aafke Engwerda et al.
European journal of human genetics : EJHG, 26(10), 1478-1489 (2018-06-16)
Proximal 6q (6q11-q15) deletions are extremely rare and little is known about their phenotypic consequences. Since parents and caregivers now use social media to seek information on rare disorders, the Chromosome 6 Project has successfully collaborated with a Facebook group
Soumya Negi et al.
Developmental biology, 446(2), 180-192 (2018-12-31)
The evolutionarily conserved transcription factor, Tbx18, is expressed in a dynamic pattern throughout embryonic and early postnatal life and plays crucial roles in the development of multiple organ systems. Previous studies have indicated that this dynamic function is controlled by
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico