SAB1412202

ANTI-ROR2 antibody produced in mouse

clone 2A10, purified immunoglobulin, buffered aqueous solution

• Sinónimos: BDB, BDB1, MGC163394, NTRKR2, ROR2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2A10, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen 37.84 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_004560
• Nº de acceso UniProt: Q01974
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ROR2(4920)

Descripción

Descripción general

Receptor tyrosine kinase-like orphan receptor 2 (ROR2) gene, spanning 228kb with nine exons, is mapped to human chromosome 9q22.31. The gene codes for a member of Ror family of receptor tyrosine kinases.

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance. (provided by RefSeq)

Inmunógeno

ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT

Acciones bioquímicas o fisiológicas

Receptor tyrosine kinase-like orphan receptor 2 (ROR2) might interact with Wnt5a to stimulate non-canonical Wnt signaling pathway. The encoded protein plays a vital role in chondrocyte lineage and it might be involved in cartilage and growth plate development. Genetic variation in the gene leads to autosomal dominant brachydactyly type B1 (BDB1) and autosomal recessive Robinow syndrome.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable