SAB1409778

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 3H5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: ACS3, BPES2, BPES3, SCS, TWIST, bHLHa38
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (i); IP; WB
• clon: 3H5, monoclonal
• reactividad de especies: human
• citations: 2
• técnicas: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3H5, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 33.22 kDa
• reactividad de especies: human
• técnicas: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_000474
• Nº de acceso UniProt: Q15672
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TWIST1(7291)

Descripción

Descripción general

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. (provided by RefSeq)

Inmunógeno

TWIST1 (NP_000465.1, 106 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable