SAB1409359

Monoclonal Anti-NEU2 antibody produced in mouse

clone 3G9, purified immunoglobulin, buffered aqueous solution

• Sinónimos: MGC129579, SIAL2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3G9, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen 35.53 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG2aλ
• Nº de acceso NCBI: NM_005383
• Nº de acceso UniProt: Q9Y3R4
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NEU2(4759)

Descripción

Descripción general

This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. (provided by RefSeq)

Inmunógeno

NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable