SAB1407093

Anti-RAB31 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: Rab22B
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~21.45 kDa
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; western blot: 1 μg/mL
• Nº de acceso NCBI: BC001148.1
• Nº de acceso UniProt: Q13636
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RAB31(11031)

Descripción

Descripción general

Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM

Inmunógeno

RAB31 (AAH01148.1, 1 a.a. ~ 195 a.a) full-length human protein.

Sequence
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable