SAB1406878

Anti-KIAA0101 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: L5, NS5ATP9, OEATC-1, OEATC1, PAF, p15(PAF)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~12.32 kDa
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; western blot: 1 μg/mL
• Nº de acceso NCBI: NM_014736.4
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... KIAA0101(9768)

Descripción

Descripción general

KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), is a proliferating cell nuclear antigen-associated factor. It is a 15kDa protein. It is highly expressed in thymus and colon. KIAA0101 gene is located on the human chromosome 15q22.31.

Inmunógeno

KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.

Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Acciones bioquímicas o fisiológicas

KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), helps in regulating DNA repair, cell cycle progression and cell proliferation. Overexpression of KIAA0101 inhibits UV-induced cell death. It is also used as a prognostic marker for hepatocellular carcinoma(HCC). Overexpression of KIAA0101 acts as a marker for adrenocortical carcinoma (ACC) and human gastric cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable