Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

SAB1404792

Sigma-Aldrich

Monoclonal Anti-RBM6, (C-terminal) antibody produced in mouse

clone 4B3, purified immunoglobulin, buffered aqueous solution

Sinónimos:

3G2, DEF-3, DEF3, DKFZp686B0877, FLJ36517, HLC-11, NY-LU-12, g16

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
490,00 €

490,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μG
490,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

490,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4B3, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen ~37.11 kDa

reactividad de especies

human

técnicas

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... RBM6(10180)

Descripción general

Mouse monoclonal antibody raised against a partial recombinant RBM6. RNA binding motif protein 6 (RBM6) is expressed in peripheral blood leukocytes, thymus and lymph nodes. The gene encoding it is localized on human chromosome 3p21.3 and has 21 exons.

Inmunógeno

RBM6 (NP_005768.1, 1024 a.a. ~ 1123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD

Acciones bioquímicas o fisiológicas

RNA binding motif protein 6 (RBM6) associates with RNA. It has been linked to lung cancers.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Elias G Bechara et al.
Molecular cell, 52(5), 720-733 (2013-12-18)
RBM5, a regulator of alternative splicing of apoptotic genes, and its highly homologous RBM6 and RBM10 are RNA-binding proteins frequently deleted or mutated in lung cancer. We report that RBM5/6 and RBM10 antagonistically regulate the proliferative capacity of cancer cells
Ting-lei Gu et al.
Blood, 110(1), 323-333 (2007-03-16)
Activated tyrosine kinases have been frequently implicated in the pathogenesis of cancer, including acute myeloid leukemia (AML), and are validated targets for therapeutic intervention with small-molecule kinase inhibitors. To identify novel activated tyrosine kinases in AML, we used a discovery
Ke Wang et al.
BMC genomics, 8, 348-348 (2007-10-03)
Transcription-induced chimerism, a mechanism involving the transcription and intergenic splicing of two consecutive genes, has recently been estimated to account for approximately 5% of the human transcriptome. Despite this prevalence, the regulation and function of these fused transcripts remains largely

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico