SAB1404482

Monoclonal Anti-TNP1 antibody produced in mouse

clone 1F12, ascites fluid

• Sinónimos: TP1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 1F12, monoclonal
• mol peso: antigen ~32.16 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgMκ
• Nº de acceso NCBI: BC029516
• Nº de acceso UniProt: P09430
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TNP1(7141)

Descripción

Descripción general

Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM

Inmunógeno

TNP1 (AAH29516.1, 1 a.a. ~ 55 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Forma física

Clear solution

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable