SAB1404116

Monoclonal Anti-NELL1 antibody produced in mouse

clone 3F1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: FLJ45906, IDH3GL, NRP1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3F1, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~37.11 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_006157
• Nº de acceso UniProt: Q92832
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NELL1(4745)

Descripción

Descripción general

This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable