SAB1403776

Monoclonal Anti-EP300 antibody produced in mouse

clone 1D2, ascites fluid

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 1D2, monoclonal
• mol peso: antigen ~37.11 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1:500-1:1000
• isotipo: IgG1
• Nº de acceso NCBI: NM_001429
• Nº de acceso UniProt: Q09472
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... EP300(2033)

Descripción

Descripción general

This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. (provided by RefSeq)

Inmunógeno

EP300 (NP_001420, 731 a.a. ~ 830 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN

Acciones bioquímicas o fisiológicas

E1A binding protein p300 (p300) and CBP (CREB binding protein) are highly related transcriptional coactivators. Both proteins have been identified through protein interaction assays. In addition to interacting with a variety of cellular factors and oncoproteins, loss of the wild type CBP alleles in isolated tumors suggests that CBP/p300 might serve as tumor suppressors. The ability of p300 to acetylate many transcription factors, including tumor suppressor p53, E2 factor (E2F), transcription factors II E and -F (TFIIE and -F) etc. demonstrates a novel mechanism of targeted p300 regulation of gene expression. Mutations in the gene encoding the protein have been linked to Rubinstein-Taybi syndrome (RSTS).

Forma física

Clear solution

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable