SAB1402266

Monoclonal Anti-MCM4 antibody produced in mouse

clone 1A6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: CDC21, CDC54, MGC33310, P1-CDC21, hCdc21
• Número MDL: MFCD02263651
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1A6, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~37 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: BC031061
• Nº de acceso UniProt: P33991
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MCM4(4173)

Descripción

Descripción general

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)

Inmunógeno

MCM4 (AAH31061, 267 a.a. ~ 366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQT

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable