SAB1401803

Monoclonal Anti-MOSPD3 antibody produced in mouse

clone 1H6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: CDS3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1H6, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: capture ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_023948
• Nº de acceso UniProt: O75425
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MOSPD3(64598)

Descripción

Descripción general

This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. (provided by RefSeq)

Inmunógeno

MOSPD3 (NP_076438, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYP

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable